PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 247aa    MW: 27919.6 Da    PI: 8.9862
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591392.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-141057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
   XP_013591392.1 10 KGAWIAEEDNLLRQCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     799*******************************************97 PP

2Myb_DNA-binding46.11.2e-1463108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++   E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_013591392.1  63 RGKFNSGEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      789999999*************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-20559IPR009057Homeodomain-like
PROSITE profilePS5129424.88561IPR017930Myb domain
SuperFamilySSF466891.39E-267104IPR009057Homeodomain-like
SMARTSM007173.1E-12959IPR001005SANT/Myb domain
PfamPF002498.4E-141057IPR001005SANT/Myb domain
CDDcd001674.97E-91257No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2260111IPR009057Homeodomain-like
SMARTSM007177.2E-1462110IPR001005SANT/Myb domain
PROSITE profilePS5129418.89262112IPR017930Myb domain
PfamPF002493.5E-1363108IPR001005SANT/Myb domain
CDDcd001671.77E-683108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEGSSKRLRK GAWIAEEDNL LRQCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS  60
INRGKFNSGE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPGCKTQM  120
KKRNLPCSST TPAQKNDVFK PRPRSFTVNN GCSHINGMPE AEFVPLCLGF NDANNVGENS  180
FTCNKDDDKS ELVSNLVDGQ NMWWESLLDE SQDPAALCPE ATATKKGATS AFDVEQLWSL  240
LDGETRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2081115107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3377920.0HQ337792.1 Brassica rapa subsp. rapa cultivar Tsuda production of anthocyanin pigment 1 (PAP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591392.10.0PREDICTED: transcription factor MYB114-like
SwissprotQ9FE251e-124MYB75_ARATH; Transcription factor MYB75
TrEMBLA0A0D3CYD20.0A0A0D3CYD2_BRAOL; Uncharacterized protein
STRINGBra004162.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.11e-125production of anthocyanin pigment 1